HPA023270

EFEMP2 antibody from Atlas Antibodies
FBLN4, UPH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023270
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023270, RRID:AB_1848019
Product name
Anti-EFEMP2
Provider product page
Atlas Antibodies - HPA023270
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAV
INDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCV
DVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRK
IGPECVDIDECRYRYCQHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -