HPA023270

EFEMP2 antibody from Sigma-Aldrich
FBLN4, UPH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023270, RRID:AB_1848019
Product name
Anti-EFEMP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023270
Antibody type
Polyclonal
Antigen
EGF-containing fibulin-like extracellular matrix protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAV
INDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCV
DVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRK
IGPECVDIDECRYRYCQHR
Storage
-20C
Provider Type Product Number
- No reagents -