Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005792 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005792, RRID:AB_1855086
- Product name
- Anti-PCP4
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETE
RAAVAIQSQFRKFQKKK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Determinants of different deep and superficial CA1 pyramidal cell dynamics during sharp-wave ripples.
DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion.
Distribution of interneurons in the CA2 region of the rat hippocampus.
The hippocampal CA2 region is essential for social memory.
Cell type–specific genetic and optogenetic tools reveal hippocampal CA2 circuits
Valero M, Cid E, Averkin RG, Aguilar J, Sanchez-Aguilera A, Viney TJ, Gomez-Dominguez D, Bellistri E, de la Prida LM
Nature neuroscience 2015 Sep;18(9):1281-1290
Nature neuroscience 2015 Sep;18(9):1281-1290
DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion.
Zhou J, Shaikh LH, Neogi SG, McFarlane I, Zhao W, Figg N, Brighton CA, Maniero C, Teo AE, Azizan EA, Brown MJ
Hypertension (Dallas, Tex. : 1979) 2015 May;65(5):1103-10
Hypertension (Dallas, Tex. : 1979) 2015 May;65(5):1103-10
Distribution of interneurons in the CA2 region of the rat hippocampus.
Botcher NA, Falck JE, Thomson AM, Mercer A
Frontiers in neuroanatomy 2014;8:104
Frontiers in neuroanatomy 2014;8:104
The hippocampal CA2 region is essential for social memory.
Hitti FL, Siegelbaum SA
Nature 2014 Apr 3;508(7494):88-92
Nature 2014 Apr 3;508(7494):88-92
Cell type–specific genetic and optogenetic tools reveal hippocampal CA2 circuits
Kohara K, Pignatelli M, Rivest A, Jung H, Kitamura T, Suh J, Frank D, Kajikawa K, Mise N, Obata Y, Wickersham I, Tonegawa S
Nature Neuroscience 2013 December;17(2):269-279
Nature Neuroscience 2013 December;17(2):269-279
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005792 antibody. Corresponding PCP4 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebral cortex shows strong positivity in the deep layers neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
- Sample type
- HUMAN