HPA026859

MINPP1 antibody from Sigma-Aldrich
MIPP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026859, RRID:AB_1853961
Product name
Anti-MINPP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026859
Antibody type
Polyclonal
Antigen
Multiple inositol polyphosphate phosphatase 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDG
GASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQ
DMRQLALRLASLFPALFSRENYGRLRLITSSKHRC
MDSSAAFLQGLWQHYHPGL
Storage
-20C
Provider Type Product Number
- No reagents -