HPA007832

PRMT3 antibody from Sigma-Aldrich
HRMT1L3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007832, RRID:AB_1855721
Product name
Anti-PRMT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007832
Antibody type
Polyclonal
Antigen
Protein arginine N-methyltransferase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIR
LKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQ
FDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEA
RALSAEAALARAREDLQKMKQFAQDFVMHTDVRTC
SSS
Storage
-20C
Provider Type Product Number
- No reagents -