PAB21338

MORN5 antibody from Abnova Corporation
C9orf113, C9orf18, FLJ46909

Antibody data

Product number
PAB21338
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21338, RRID:AB_10970430
Product name
MORN5 polyclonal antibody
Provider product page
Abnova Corporation - PAB21338
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human MORN5.
Reactivity
Human
Host
Rabbit
Antigen sequence
YTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKD
GMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSD
GLHYD
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -