HPA020930

MORN5 antibody from Sigma-Aldrich
C9orf113, C9orf18, FLJ46909
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020930
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020930, RRID:AB_2266613
Product name
Anti-MORN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020930
Antibody type
Polyclonal
Antigen
MORN repeat-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKD
GMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSD
GLHYD
Storage
-20C
Provider Type Product Number
- No reagents -