HPA014394

NEMP1 antibody from MilliporeSigma / Merck KGaA
KIAA0286, TMEM194, TMEM194A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014394
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014394, RRID:AB_2204899
Product name
Anti-TMEM194A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014394
Antibody type
Polyclonal
Antigen
Transmembrane protein 194 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTE
EEYRIQGEVETRKALEELREFCNSPDCSAWKTVSR
IQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSII
AQDEIYEEASSEEEDSYSRCPAITQNNF
Storage
-20C
Provider Type Product Number
- No reagents -