HPA006311

GSTK1 antibody from Sigma-Aldrich
GST13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006311
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006311, RRID:AB_1849786
Product name
Anti-GSTK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006311
Antibody type
Polyclonal
Antigen
Glutathione S-transferase kappa 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPI
TVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPP
AVN
Storage
-20C
Provider Type Product Number
- No reagents -