ABIN406174

SERTAD2 antibody from antibodies-online
KIAA0127, Sei-2, TRIP-Br2

Antibody data

Product number
ABIN406174
Provider
antibodies-online
Product name
anti-SERTA Domain Containing 2 (SERTAD2) (N-Term) antibody
Provider product page
antibodies-online - ABIN406174
Antibody type
Polyclonal
Antigen
The immunogen for anti-SERTAD2 antibody: synthetic peptide directed towards the N terminal of human SERTAD2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
LQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNML
RRIQE ELKQEGSLRP
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -