HPA019021

SERTAD2 antibody from MilliporeSigma / Merck KGaA
KIAA0127, Sei-2, TRIP-Br2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019021
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019021, RRID:AB_1856740
Product name
Anti-SERTAD2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019021
Antibody type
Polyclonal
Antigen
SERTA domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQ
KTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTE
PSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACL
TPASLLEDDDDTFCTSQ
Storage
-20C
Provider Type Product Number
- No reagents -