HPA020904

SERTAD2 antibody from Sigma-Aldrich
KIAA0127, Sei-2, TRIP-Br2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020904
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020904, RRID:AB_1856741
Product name
Anti-SERTAD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020904
Antibody type
Polyclonal
Antigen
SERTA domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPPALLPEKDSFSSALDEIEELCPTSTSTEAATAA
TDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPG
NFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCT
SSSGTASKMAPVSADDLLKTLAP
Storage
-20C
Provider Type Product Number
- No reagents -