HPA008394

SYT1 antibody from Sigma-Aldrich
P65, SVP65, SYT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008394
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008394, RRID:AB_1857696
Product name
Anti-SYT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008394
Antibody type
Polyclonal
Antigen
Synaptotagmin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDG
EEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQ
Storage
-20C
Provider Type Product Number
- No reagents -