HPA026721

DHDDS antibody from Atlas Antibodies
DS, FLJ13102, hCIT, HDS, RP59

Antibody data

Product number
HPA026721
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026721, RRID:AB_1847643
Product name
Anti-DHDDS
Provider product page
Atlas Antibodies - HPA026721
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIR
VLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCF
AYTSRHEISNA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.