HPA026727

DHDDS antibody from Atlas Antibodies
DS, FLJ13102, hCIT, HDS, RP59
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026727
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026727, RRID:AB_1847644
Product name
Anti-DHDDS
Provider product page
Atlas Antibodies - HPA026727
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HSVLQKARDMYAEERKRQQLERDQATVTEQLLREG
LQASGDAQLRRTRLHKLSARREERVQGFLQALELK
RADWLARLGTASA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -