Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406026 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DHDDS antibody: synthetic peptide directed towards the N terminal of human DHDDS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGI
LEVTV YAFSIENFKR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Polyprenyl lipid synthesis in mammalian cells expressing human cis-prenyl transferase.
Women's attractiveness judgments of self-resembling faces change across the menstrual cycle.
Jones J, Viswanathan K, Krag SS, Betenbaugh MJ
Biochemical and biophysical research communications 2005 Jun 3;331(2):379-83
Biochemical and biophysical research communications 2005 Jun 3;331(2):379-83
Women's attractiveness judgments of self-resembling faces change across the menstrual cycle.
DeBruine LM, Jones BC, Perrett DI
Hormones and behavior 2005 Apr;47(4):379-83
Hormones and behavior 2005 Apr;47(4):379-83
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting