HPA026721

DHDDS antibody from Sigma-Aldrich
DS, FLJ13102, hCIT, HDS, RP59
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026721
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026721, RRID:AB_1847643
Product name
Anti-DHDDS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026721
Antibody type
Polyclonal
Antigen
Dehydrodolichyl diphosphate synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIR
VLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCF
AYTSRHEISNA
Storage
-20C
Provider Type Product Number
- No reagents -