HPA020016

JADE1 antibody from MilliporeSigma / Merck KGaA
JADE-1, PHF17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020016
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020016, RRID:AB_1855292
Product name
Anti-PHF17 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020016
Antibody type
Polyclonal
Antigen
Protein Jade-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLEN
MLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLV
HSLKKPHKRDPLQNSPGSEGKTLLKQPDL
Storage
-20C
Provider Type Product Number
- No reagents -