HPA008395

NUCB2 antibody from Atlas Antibodies
NEFA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008395
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008395, RRID:AB_1854683
Product name
Anti-NUCB2
Provider product page
Atlas Antibodies - HPA008395
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETL
DQQQFFTEEELKEYENIIALQENELKKKADELQKQ
KEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIP
PSGPAGELKFEPR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -