HPA008395

NUCB2 antibody from Sigma-Aldrich
NEFA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008395
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008395, RRID:AB_1854683
Product name
Anti-NUCB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008395
Antibody type
Polyclonal
Antigen
Nucleobindin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETL
DQQQFFTEEELKEYENIIALQENELKKKADELQKQ
KEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIP
PSGPAGELKFEPR
Storage
-20C
Provider Type Product Number
- No reagents -