Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000427-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000427-M01, RRID:AB_509101
- Product name
- ASAH1 monoclonal antibody (M01), clone 2C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ASAH1.
- Antigen sequence
PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPY
KRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVM
QVVDEKLPGLLGNFPGPFEEEMKGIAAVTD- Isotype
- IgG
- Antibody clone number
- 2C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ceramide biosynthesis and metabolism in trophoblast syncytialization.
Singh AT, Dharmarajan A, Aye IL, Keelan JA
Molecular and cellular endocrinology 2012 Oct 15;362(1-2):48-59
Molecular and cellular endocrinology 2012 Oct 15;362(1-2):48-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ASAH1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ASAH1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol