HPA005468

ASAH1 antibody from Sigma-Aldrich
AC, ASAH, FLJ21558, PHP32
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005468
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005468, RRID:AB_1845062
Product name
Anti-ASAH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005468
Antibody type
Polyclonal
Antigen
Acid ceramidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGC
VITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHP
FFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKP
VLNKLTVYTTLIDVTKGQF
Storage
-20C
Provider Type Product Number
- No reagents -