Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502132 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-XPNPEP2 antibody: synthetic peptide directed towards the middle region of human XPNPEP2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFS
GAEIV DKFRGEEQFS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Metallopeptidase activities in hereditary angioedema: effect of androgen prophylaxis on plasma aminopeptidase P.
Drouet C, Désormeaux A, Robillard J, Ponard D, Bouillet L, Martin L, Kanny G, Moneret-Vautrin DA, Bosson JL, Quesada JL, López-Trascasa M, Adam A
The Journal of allergy and clinical immunology 2008 Feb;121(2):429-33
The Journal of allergy and clinical immunology 2008 Feb;121(2):429-33
No comments: Submit comment
No validations: Submit validation data