HPA000339

XPNPEP2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000339
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000339, RRID:AB_1858894
Product name
Anti-XPNPEP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000339
Antibody type
Polyclonal
Antigen
Xaa-Pro aminopeptidase 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIP
YNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNS
SCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTS
YTMYGI
Storage
-20C
Provider Type Product Number
- No reagents -