Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501583 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Annexin A10 (ANXA10) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANXA10 antibody: synthetic peptide directed towards the middle region of human ANXA10
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQE
FQNIS GQDMVDAINE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Down-regulation of annexin A10 in hepatocellular carcinoma is associated with vascular invasion, early recurrence, and poor prognosis in synergy with p53 mutation.
Liu SH, Lin CY, Peng SY, Jeng YM, Pan HW, Lai PL, Liu CL, Hsu HC
The American journal of pathology 2002 May;160(5):1831-7
The American journal of pathology 2002 May;160(5):1831-7
No comments: Submit comment
No validations: Submit validation data