HPA005571

APBB3 antibody from MilliporeSigma / Merck KGaA
FE65L2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005571
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005571, RRID:AB_1844912
Product name
Anti-APBB3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005571
Antibody type
Polyclonal
Antigen
Amyloid beta A4 precursor protein-binding family B member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAG
TYYWHVPSGSTQWQRPTWELGDAEDPGTGTEGIWG
LRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSME
PGAKCFAVRSL
Storage
-20C
Provider Type Product Number
- No reagents -