H00027232-M01A

GNMT antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00027232-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027232-M01A, RRID:AB_1137238
Product name
GNMT monoclonal antibody (M01A), clone 2B10
Provider product page
Abnova Corporation - H00027232-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GNMT.
Antigen sequence
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYI
GDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV
DSIMLVEEGFSVTSVDASDKMLKYALKERW
Isotype
IgM
Antibody clone number
2B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -