HPA005572

PCSK4 antibody from Sigma-Aldrich
DKFZp434B217, MGC34749, PC4, SPC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005572
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005572, RRID:AB_1855087
Product name
Anti-PCSK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005572
Antibody type
Polyclonal
Antigen
Proprotein convertase subtilisin/kexin type 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQV
TSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPR
FFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRG
GSPRDCTSCPPSSTLDQQQGSCMGPT
Storage
-20C
Provider Type Product Number
- No reagents -