HPA020543

SHMT2 antibody from Sigma-Aldrich
SHMT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020543
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020543, RRID:AB_1856833
Product name
Anti-SHMT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020543
Antibody type
Polyclonal
Antigen
Serine hydroxymethyltransferase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSD
SDPEMWELLQREKDRQCRGLELIASENFCSRAALE
AL
Storage
-20C
Provider Type Product Number
- No reagents -