HPA025924

PEX6 antibody from Sigma-Aldrich
PAF-2, PXAAA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025924, RRID:AB_1855230
Product name
Anti-PEX6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025924
Antibody type
Polyclonal
Antigen
Peroxisome assembly factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRD
GLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTS
RAQDLPADVQTAFPHELEVPALSEGQRLSILRALT
AHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSS
Storage
-20C
Provider Type Product Number
- No reagents -