HPA021571

PDCL antibody from Sigma-Aldrich
DKFZp564M1863, PhLP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021571
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021571, RRID:AB_1855114
Product name
Anti-PDCL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021571
Antibody type
Polyclonal
Antigen
Phosducin-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEA
MNGCMICLAAEYPAVKFCKVK
Storage
-20C
Provider Type Product Number
- No reagents -