HPA008762

NET2, p54, SFRS11

Antibody data

Submit

Validation data

Product number: HPA008762
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008762, RRID:AB_1856782
Product name: Anti-SRSF11
Provider product page: Atlas Antibodies - HPA008762
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPG ANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPS LKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEE KRRHSRSRSR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human endometrium and pancreas tissues using HPA008762 antibody. Corresponding SRSF11 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.