Antibody data
- Product number
- HPA008762
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008762, RRID:AB_1856782
- Product name
- Anti-SRSF11
- Provider product page
- Atlas Antibodies - HPA008762
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPG
ANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPS
LKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEE
KRRHSRSRSR
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and SRSF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417764).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in non-germinal center cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human endometrium and pancreas tissues using HPA008762 antibody. Corresponding SRSF11 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more