HPA008762

SRSF11 antibody from MilliporeSigma / Merck KGaA
NET2, p54, SFRS11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008762
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008762, RRID:AB_1856782
Product name
Anti-SFRS11 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008762
Antibody type
Polyclonal
Antigen
Splicing factor arginine/serine-rich 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPG
ANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPS
LKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEE
KRRHSRSRSR
Storage
-20C
Provider Type Product Number
- No reagents -