ABIN405158

antibody from antibodies-online

Targeting: BUD31 Cwc14, EDG-2, EDG2, fSAP17, G10, YCR063W

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN405158

Provider

antibodies-online

Product name

anti-BUD31 Homolog (S. Cerevisiae) (BUD31) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31

Reactivity

Human, Mouse, Rat, Bovine, Canine

Host

Rabbit

Antigen sequence

PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEP
HEGKR KVESLWPIFR


Vial size

50 µg

References

Submitted references

The DNA sequence of human chromosome 7.

Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK
Nature 2003 Jul 10;424(6945):157-64

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Image(s): Western Blotting