HPA020106

PTCD1 antibody from Sigma-Aldrich
KIAA0632
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020106
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020106, RRID:AB_2176551
Product name
Anti-PTCD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020106
Antibody type
Polyclonal
Antigen
Pentatricopeptide repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIG
GLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAE
SLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
Storage
-20C
Provider Type Product Number
- No reagents -