Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005563 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TREM1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQA
PPKSTADVSTPDSEINLTNVTDI- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Targeting the TREM1-positive myeloid microenvironment in glioblastoma
TREM-1 Is Induced in Tumor Associated Macrophages by Cyclo-Oxygenase Pathway in Human Non-Small Cell Lung Cancer
Role of TREM1-DAP12 in Renal Inflammation during Obstructive Nephropathy
Filippova N, Grimes J, Leavenworth J, Namkoong D, Yang X, King P, Crowley M, Crossman D, Nabors L
Neuro-Oncology Advances 2022;4(1)
Neuro-Oncology Advances 2022;4(1)
TREM-1 Is Induced in Tumor Associated Macrophages by Cyclo-Oxygenase Pathway in Human Non-Small Cell Lung Cancer
Mattei F, Yuan Z, Mehta H, Mohammed K, Nasreen N, Roman R, Brantly M, Sadikot R
PLoS ONE 2014;9(5):e94241
PLoS ONE 2014;9(5):e94241
Role of TREM1-DAP12 in Renal Inflammation during Obstructive Nephropathy
Armando I, Tammaro A, Stroo I, Rampanelli E, Blank F, Butter L, Claessen N, Takai T, Colonna M, Leemans J, Florquin S, Dessing M
PLoS ONE 2013;8(12):e82498
PLoS ONE 2013;8(12):e82498
No comments: Submit comment
No validations: Submit validation data