HPA005563

TREM1 antibody from Sigma-Aldrich
CD354, TREM-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005563
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005563, RRID:AB_1858259
Product name
Anti-TREM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005563
Antibody type
Polyclonal
Antigen
Triggering receptor expressed on myeloid cells 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQA
PPKSTADVSTPDSEINLTNVTDI
Storage
-20C
Provider Type Product Number
- No reagents -