HPA021444

ZBTB26 antibody from Atlas Antibodies
ZNF481
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021444
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021444, RRID:AB_1858948
Product name
Anti-ZBTB26
Provider product page
Atlas Antibodies - HPA021444
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSK
KDQNQFISSEPTALHSSEPQHSLINSTVENRVSEI
EQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -