HPA021444

ZBTB26 antibody from Sigma-Aldrich
ZNF481
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021444
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021444, RRID:AB_1858948
Product name
Anti-ZBTB26 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021444
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 26 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSK
KDQNQFISSEPTALHSSEPQHSLINSTVENRVSEI
EQ
Storage
-20C
Provider Type Product Number
- No reagents -