HPA006117

SCIMP antibody from Sigma-Aldrich
C17orf87, DTFT5783, FLJ32580, MGC163426, MGC163428, UNQ5783
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006117
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006117, RRID:AB_1858633
Product name
Anti-C17orf87 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006117
Antibody type
Polyclonal
Antigen
Transmembrane protein C17orf87 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLP
PLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNK
KTVSIPSYIEPEDDYDDVEIPANTE
Storage
-20C
Provider Type Product Number
- No reagents -