HPA005855

CDC25A antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005855
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005855, RRID:AB_1846364
Product name
Anti-CDC25A
Provider product page
Atlas Antibodies - HPA005855
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VAGKHQDLKYISPEIMASVLNGKFANLIKEFVIID
CRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVP
TDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNE
YPKLHYPELYVLKGGYKEFFMKCQSY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -