HPA005855

CDC25A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005855
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005855, RRID:AB_1846364
Product name
Anti-CDC25A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005855
Antibody type
Polyclonal
Antigen
M-phase inducer phosphatase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAGKHQDLKYISPEIMASVLNGKFANLIKEFVIID
CRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVP
TDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNE
YPKLHYPELYVLKGGYKEFFMKCQSY
Storage
-20C
Provider Type Product Number
- No reagents -