HPA003084

MDGA2 antibody from Sigma-Aldrich
MAMDC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003084, RRID:AB_1079302
Product name
Anti-MDGA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003084
Antibody type
Polyclonal
Antigen
MAM domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVL
RAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVK
SLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPE
FYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV
Storage
-20C
Provider Type Product Number
- No reagents -