HPA005857

FBP1 antibody from Sigma-Aldrich
FBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005857
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005857, RRID:AB_1848445
Product name
Anti-FBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005857
Antibody type
Polyclonal
Antigen
Fructose-1,6-bisphosphatase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVA
AGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILV
DKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKK
FPPDNSAP
Storage
-20C
Provider Type Product Number
- No reagents -