HPA017921

MEA1 antibody from Sigma-Aldrich
MEA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017921
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017921, RRID:AB_1853708
Product name
Anti-MEA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017921
Antibody type
Polyclonal
Antigen
Male-enhanced antigen 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALNNHSSIPMDPEHVELVKRTMAGVSLPAPGVPAW
AREISDAQWEDVVQKALQARQAS
Storage
-20C
Provider Type Product Number
- No reagents -