Antibody data

Product number
PAB20325
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20325, RRID:AB_10961951
Product name
MORN1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20325
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human MORN1.
Reactivity
Human
Host
Rabbit
Antigen sequence
YYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEP
QGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQ
VYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQ
GHGVLRCADGSTYKGQWHSDVFSGLGS
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -