HPA005858

MORN1 antibody from Sigma-Aldrich
FLJ13941
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005858
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005858, RRID:AB_1848709
Product name
Anti-MORN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005858
Antibody type
Polyclonal
Antigen
MORN repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEP
QGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQ
VYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQ
GHGVLRCADGSTYKGQWHSDVFSGLGS
Storage
-20C
Provider Type Product Number
- No reagents -