HPA016843

INHBE antibody from Sigma-Aldrich
activin, MGC4638
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016843
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016843, RRID:AB_1851796
Product name
Anti-INHBE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016843
Antibody type
Polyclonal
Antigen
Inhibin beta E chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANE
PGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWR
DWILQPEGYQLNYCSGQCPPHLAG
Storage
-20C
Provider Type Product Number
- No reagents -