HPA016843

INHBE antibody from Atlas Antibodies
activin, MGC4638

Antibody data

Product number
HPA016843
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016843, RRID:AB_1851796
Product name
Anti-INHBE
Provider product page
Atlas Antibodies - HPA016843
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANE
PGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWR
DWILQPEGYQLNYCSGQCPPHLAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.