HPA010609

ARHGEF16 antibody from Sigma-Aldrich
GEF16, NBR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010609
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010609, RRID:AB_1845004
Product name
Anti-ARHGEF16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010609
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHH
HLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISD
ILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNA
AFREALREIERRPACGGLPMLSFLILPMQRVTRLP
LLMDTLC
Storage
-20C
Provider Type Product Number
- No reagents -